PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0693s0030.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HB-other
Protein Properties Length: 1739aa    MW: 195057 Da    PI: 5.3678
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0693s0030.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.6e-182682157
                            TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                            ++kR   t++qle+Le+ ++ + yps++ r+eL+ +lgL++rq ++WF+ rR k++k
  SapurV1A.0693s0030.1.p 26 KSKRKMKTASQLEILEKTYAVDTYPSEAVRAELSVQLGLSDRQLQMWFCHRRLKDRK 82
                            679****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-171282IPR009057Homeodomain-like
SuperFamilySSF466897.7E-162282IPR009057Homeodomain-like
PROSITE profilePS5007116.5682383IPR001356Homeobox domain
SMARTSM003891.2E-162587IPR001356Homeobox domain
PfamPF000464.4E-162682IPR001356Homeobox domain
CDDcd000861.74E-142682No hitNo description
SMARTSM005711.8E-21532591IPR018501DDT domain
PROSITE profilePS5082716.381532591IPR018501DDT domain
PfamPF027911.7E-16533588IPR018501DDT domain
PfamPF050661.5E-13714780IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156126.7E-9930972IPR028942WHIM1 domain
PfamPF156131.2E-1311131185IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1739 aa     Download sequence    Send to blast
MEEAADDGGG VEVEEKKKTP GEGESKSKRK MKTASQLEIL EKTYAVDTYP SEAVRAELSV  60
QLGLSDRQLQ MWFCHRRLKD RKGPLAKRPH KESPSSAGMP GGVEMGVGTE VGNEHGSGSA  120
SPFGLGMDSR RAVGRPTGVA VPRISADVQA MKRYYEPQQS VAELRAIAFV KAQLGEPLRE  180
DGPILGMDFD PLPPDAFGAP IGSATAGQQK QPLRIFETNL YERPDVKPIK GTKRTLHEYQ  240
FLPQQPTVRA EAYERAAPSY PYGSPADGFS SQVPSLSLMP QEGRQGHLLP SASGEYESTS  300
QKSPFTNVGM DVQVGAHPIT ALDNPFMSSD QRVTHDEDVL RMERKRKSEE ARIAREVEAH  360
EKRIRKELEK QDILRRKREE QIRKEMERHD RERRKEEERL LREKQREVER YQREQRRELE  420
RREKFLQKES IRVAKMRQKE ELRREREAAR QKAASERAIA RRMAKESMEL VEDERLELLE  480
LAASSKGLPS IFPMDFETLQ NLDIFRDKLT EFPPKSVLLK RPFLVQPWNG SEENIGNLLM  540
VWRFLITFVD VLGIWPFTLD EFVQAFHDYE PRLLGEIHIS LLKSIIKDIE DVARTPATGL  600
GPNQNSAANP GGGHPQIVEG AYAWGFDLRS WQRHLNPLTW PEILRQFGLS AGFGPQLKKR  660
NVEHAYLRDD NEGNDGEDVI TNLRNGAAVE NAFAIMQERG FSNPRRSRHR LTPGTVKFAS  720
FHVLSLEGSK GLTILEVADK IQKSGLRDLT TSKTPEASIA AALSRDSKLF ERTAPSTYCV  780
HPPYRKDPAD AEAILSAARE RIRVFKSSIV DGEDADDAER DEDSESDVAE DPDIDDLGTE  840
LNSKKEAPDS PEVNEFNGKT LLMNGKESGD VLKTPQVSLV NVGVDLTSLH SGGTNEVKEV  900
ASSIDRSVDV AEIRSTPEQG DVDIDESNPG EPWVQGLVDG EYSDLSVEER LSALVALIGV  960
AIEGNSIRVV LEERLEAANA LKKQMWAEAQ LDKRRMKEEF VTRTQYSSCT GNKMELNLTI  1020
SASEGRQSPM VSVDDRSNGM PVNASFQQER SSDQQSDMNY MTNMSSERNM RMQDLSADPD  1080
NLPYQQAGHA TEKSRAQLKS VIGHRAEEIY VYRSLPLGQD RRRNRYWQFT TSASLNDPGC  1140
GRIFVELHDG RWRVIDSEEG FNALLSSLDV RGVRESHLHA MLHKIEVPFK ETLRRRMLHA  1200
ITEGKSKGPI KAEAVETAAG IDCGSGMDSP QSTVCIPDSE MSETSTSFTV ELGRNEIEKK  1260
HALKRFQDFE KWMWKECFNS SVLCAMKYGK KRCTQLLGVC DFCHDTYLSE DNHCPCCHKT  1320
YDVSQIDLNF SEHMAHCERK LKVDPDSALC GSSFPQRIRL LKSLLALIEV SVLPEALQPF  1380
WTNDYRKSWG MKLQSSSSVE DLLQILTPLE SSMKRDYMSS DYETSSELLR SSGQSGCAAY  1440
GSFNTVTVPV LPWLPQTTAA VALRVIEFDA SISYMLHQKL EAHKDRSTGN FIKLPSKYAA  1500
LKNTPDHETT ETPCEAGLFQ EDNWVDVGIG SAGLGREQGI RGRGRGRTRG GRSQTRIIGS  1560
RSVSSKRSVA RSNDRLGKVL SWKGRPRGRG GHKRGRRSVR SRQKVVKQAA DFIPERKIPI  1620
ETIREQSTKY LGRDDWNGDE TRFAEDAENA SSSEYDDENE NIPASGDEYH MGVDDYAGGF  1680
NGKSDDIQEG SDYIMDGNED NDDAGNEDED ELGDLNVEEY INRDPDDVSE STSSDFSD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2313460.0CU231346.1 Populus EST from mild drought-stressed leaves.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011043631.10.0PREDICTED: uncharacterized protein LOC105139032 isoform X1
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLU5FK090.0U5FK09_POPTR; Uncharacterized protein
STRINGPOPTR_0017s04760.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25233369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator